HEMGN Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 17616-1-AP (same clone as 17616-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17616-1-AP (HEMGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 17616-1-AP (same clone as 17616-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17616-1-AP (HEMGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 17616-1-AP (same clone as 17616-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 17616-1-AP (HEMGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 17616-1-AP (same clone as 17616-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 17616-1-AP (HEMGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 17616-1-AP (same clone as 17616-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17616-1-AP (HEMGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 17616-1-AP (same clone as 17616-1-PBS)

  IP result of anti-HEMGN (IP:17616-1-AP, 4ug; Detection:17616-1-AP 1:500) with HL-60 cells lysate 3000ug. This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17616-1-AP (same clone as 17616-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17616-1-AP (HEMGN antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17616-1-AP (same clone as 17616-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17616-1-AP (HEMGN antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17616-1-PBS in a different storage buffer formulation.

HEMGN Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17616-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

17616-1-PBS targets HEMGN in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11793

  Product name: Recombinant human HEMGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 139-483 aa of BC048324

  Sequence: SNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF

• Full Name: hemogen
• Calculated Molecular Weight: 483 aa, 55 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC048324
• Gene Symbol: HEMGN
• Gene ID (NCBI): 55363
• RRID: AB_2117676
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXL5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.