HES1 Polyclonal antibody

• 

HES1 Polyclonal Antibody for ELISA

Cat No. 27542-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

Human and More (3)

Applications

WB, ELISA

Synonyms

bHLHb39, Hairy and enhancer of split 1, Hairy homolog, Hairy like protein, HES 1, HES1, HHL, HL, HRY, Transcription factor HES 1

---

Published Applications

• WB: See 4 publications below

Product Information

27542-1-AP targets HES1 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26393

  Product name: Recombinant human HES1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC039152

  Sequence: MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

• Full Name: hairy and enhancer of split 1, (Drosophila)
• Calculated Molecular Weight: 30 kDa
• GenBank Accession Number: BC039152
• Gene Symbol: HES1
• Gene ID (NCBI): 3280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14469
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Lipids Health Dis; Exposure to PM2.5 affects blood lipid levels in asthmatic rats through notch signaling pathway.; Authors - Tianrong Zhang
human	WB	Am J Cancer Res; MOGS promotes stemness acquisition and invasion via enhancing NOTCH1-glycosylation dependent NOTCH pathway in colorectal cancer; Authors - Shihai Zhou
human	WB	J Nutr Biochem; ZNF217-activated Notch signaling mediates sulforaphane-suppressed stem cell properties in colorectal cancer; Authors - Menghuan Wang
mouse	WB	Cell Mol Life Sci; Cathepsin K deficiency prevented stress-related thrombosis in a mouse FeCl3 model; Authors - Xueying Jin