HIRA Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00291-1

  Sandwich ELISA standard curve of MP00291-1, Human HIRA Recombinant Matched Antibody Pair - PBS only. 83194-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag34439. 83194-1-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL

• 

  Sample test of MP00291-1

  K-562 cell lysates were measured. The human HIAR concentration of detected samples was determined to be 9.93 ng/mL (based on a 4.5 mg/mL extract load) in K-562 cell lysate.

• 

  Cytometric bead array standard curve of MP00291-1

  Cytometric bead array standard curve of MP00291-1, HIRA Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83194-3-PBS. Detection antibody: 83194-1-PBS. Standard: Ag34439. Range: 0.625-20 ng/mL.

HIRA Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83194-3-PBS

Clone No.240006C5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Protein HIRA, HIRA/HIR, HIR, 240006C5

---

Product Information

83194-3-PBS targets HIRA as part of a matched antibody pair:

MP00291-1: 83194-3-PBS capture and 83194-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34439

  Product name: Recombinant human HIRA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 850-1017 aa of NM_003325

  Sequence: SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK

• Full Name: HIR histone cell cycle regulation defective homolog A (S. cerevisiae)
• Calculated Molecular Weight: 112 kDa
• GenBank Accession Number: NM_003325
• Gene Symbol: HIRA
• Gene ID (NCBI): 7290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54198
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.