Use Able AI chat for product recommendations

HLA-E Monoclonal antibody

HLA-E Monoclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 66530-1-Ig
Clone No.1A4G3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF-P, IP, ELISA

1A4G3, HLA 6.2, HLA E, HLA-6.2, HLAE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, Jurkat cells, HUVEC cells, human placenta tissue, Ramos cells, Daudi cells, Raji cells
Positive IP detected inTHP-1 cells
Positive IHC detected inhuman tonsillitis tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2500-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66530-1-Ig targets HLA-E in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6724

Product name: Recombinant human HLA-E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-303 aa of BC002578

Sequence: SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTI

Predict reactive species
Full Name major histocompatibility complex, class I, E
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC002578
Gene Symbol HLA-E
Gene ID (NCBI) 3133
RRIDAB_2881893
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13747
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-E is a non-classical MHC class I molecule. HLA-E is frequently overexpressed in tumor diseases, transplants and virus-infected cells and represents an immunomodulatory molecule by binding to the receptors CD94/NKG2A, -B and -C on NK and T cells. Due to its immune suppressive features HLA-E expression might represent an important mechanism of tumors to escape immune surveillance.(PMID: 667938; 3375250; 2249951; 27589686)

Protocols

Product Specific Protocols
IF protocol for HLA-E antibody 66530-1-IgDownload protocol
IHC protocol for HLA-E antibody 66530-1-IgDownload protocol
IP protocol for HLA-E antibody 66530-1-IgDownload protocol
WB protocol for HLA-E antibody 66530-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Cell

Single-cell dissection of the human motor and prefrontal cortices in ALS and FTLD

Authors - S Sebastian Pineda

Cell Rep

Dual blockade of PD-1 and NKG2A prevents NK cell senescence and reprograms the immunosuppressive microenvironment in pancreatic cancer.

Authors - Yu Zhang
humanIHC

Nat Med

Allogeneic NK cells with a bispecific innate cell engager in refractory relapsed lymphoma: a phase 1 trial

Authors - Yago Nieto
humanIHC

J Exp Clin Cancer Res

PD-1(+) NK cell subsets in high grade serous ovarian cancer: an indicator of disease severity and a target for combined immune-checkpoint blockade.

Authors - Marco Greppi
humanWB

Cancer Cell

Immune checkpoint HLA-E:CD94-NKG2A mediates evasion of circulating tumor cells from NK cell surveillance

Authors - Xiaowei Liu
  • KD Validated
WB

J Exp Clin Cancer Res

Targeting the HLA-E-NKG2A axis in combination with MS-275 enhances NK cell-based immunotherapy against DMG

Authors - Yuxuan Deng
Loading...
||
New chat

Able

正在加载,请稍候...