HLA-E Monoclonal antibody, PBS Only

HLA-E Monoclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 66530-1-PBS
Clone No.1A4G3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF-P, IP, Indirect ELISA

1A4G3, HLA 6.2, HLA E, HLA-6.2, HLAE

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66530-1-PBS targets HLA-E in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6724

Product name: Recombinant human HLA-E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-303 aa of BC002578

Sequence: SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTI

Predict reactive species
Full Name major histocompatibility complex, class I, E
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC002578
Gene Symbol HLA-E
Gene ID (NCBI) 3133
RRIDAB_2881893
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13747
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-E is a non-classical MHC class I molecule. HLA-E is frequently overexpressed in tumor diseases, transplants and virus-infected cells and represents an immunomodulatory molecule by binding to the receptors CD94/NKG2A, -B and -C on NK and T cells. Due to its immune suppressive features HLA-E expression might represent an important mechanism of tumors to escape immune surveillance.(PMID: 667938; 3375250; 2249951; 27589686)

Loading...
||
New chat

Able

正在加载,请稍候...