CoraLite® Plus 488-conjugated HLA-E Monoclonal antibody

• 

  WB analysis of Raji using CL488-66530

  Raji cells were subjected to SDS PAGE followed by western blot with CL488-66530 (HLA-E antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

HLA-E Monoclonal Antibody for WB

Cat No. CL488-66530

Clone No.1A4G3

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB

Synonyms

DKFZp686P19218, EA1.2, EA2.1, HLA 6.2, HLA E, HLAE, HLA-E, MHC, MHC class I antigen E, QA1

---

Tested Applications

• Positive WB detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66530 targets HLA-E in WB applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6724

  Product name: Recombinant human HLA-E protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 23-303 aa of BC002578

  Sequence: SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTI

• Full Name: major histocompatibility complex, class I, E
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC002578
• Gene Symbol: HLA-E
• Gene ID (NCBI): 3133
• RRID: AB_2919339
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13747
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-E is a non-classical MHC class I molecule. HLA-E is frequently overexpressed in tumor diseases, transplants and virus-infected cells and represents an immunomodulatory molecule by binding to the receptors CD94/NKG2A, -B and -C on NK and T cells. Due to its immune suppressive features HLA-E expression might represent an important mechanism of tumors to escape immune surveillance.(PMID: 667938; 3375250; 2249951; 27589686)