HLA-F Polyclonal antibody

• 

  WB analysis of Raji using 14670-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 14670-1-AP (HLA-F antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 14670-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 14670-1-AP (HLA-F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 14670-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 14670-1-AP (HLA-F antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 14670-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 14670-1-AP (HLA-F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 14670-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 14670-1-AP (HLA-F antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A431 using 14670-1-AP

  IP result of anti-HLA-F (IP:14670-1-AP, 4ug; Detection:14670-1-AP 1:3000) with A431 cells lysate 1040 ug.

• 

  IHC staining of human tonsillitis using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14670-1-AP (HLA-F antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14670-1-AP (HLA-F antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen slide using 14670-1-AP (HLA-F Antibody) at dilution of 1:50.

• 

  IHC staining of human spleen using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen slide using 14670-1-AP (HLA-F Antibody) at dilution of 1:50.

• 

  IHC staining of human skin cancer using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer using 14670-1-AP (HLA-F antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin cancer using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer using 14670-1-AP (HLA-F antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human placenta using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta slide using 14670-1-AP (HLA-F Antibody) at dilution of 1:50.

• 

  IHC staining of human placenta using 14670-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta slide using 14670-1-AP (HLA-F Antibody) at dilution of 1:50.

• Featured Product
• KD/KO Validated

HLA-F Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14670-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CDA12, HLA 5.4, HLA CDA12, HLA F, HLA F antigen

---

Tested Applications

• Positive WB detected in: Raji cells, human placenta tissue, human spleen tissue, A431 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human tonsillitis tissue, human placenta tissue, human skin cancer tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 7 publications below
• IF: See 1 publications below

Product Information

14670-1-AP targets HLA-F in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6335

  Product name: Recombinant human HLA-F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-298 aa of BC062991

  Sequence: AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS

• Full Name: major histocompatibility complex, class I, F
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40-45 kDa
• GenBank Accession Number: BC062991
• Gene Symbol: HLA-F
• Gene ID (NCBI): 3134
• RRID: AB_1519280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30511
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-F is a non-classical MHC class I molecule. (PMID: 667938; 3375250; 2249951)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	Kidney Int; Upregulation of HLA-F expression by BK polyomavirus infection induces immune recognition by KIR3DS1-positive natural killer cells.; Authors - Tobias F Koyro
human	IHC	Int J Cancer; Alteration of HLA-F and HLA I antigen expression in the tumor is associated with survival in patients with esophageal squamous cell carcinoma.; Authors - Zhang X X
		J Immunol; Immune Modifications in Fetal Membranes Overlying the Cervix Precede Parturition in Humans.; Authors - Louis Marcellin
mouse,human	WB	Int J Biol Sci; Targeting HLA-F suppresses the proliferation of glioma cells via a reduction in hexokinase 2-dependent glycolysis.; Authors - Xin Chen ; KD Validated
human	WB,IHC	Lung Cancer; HLA-F expression is a prognostic factor in patients with non-small-cell lung cancer.; Authors - Lin Aifen A
human	IHC	Oncol Lett; Lesion human leukocyte antigen-F expression is associated with a poor prognosis in patients with hepatocellular carcinoma.; Authors - Yongfu Xu