• Featured Product
  • KD/KO Validated

HLA-F Polyclonal antibody

HLA-F Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 14670-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, ELISA

CDA12, HLA 5.4, HLA CDA12, HLA F, HLA F antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, human placenta tissue, human spleen tissue, A431 cells
Positive IP detected inA431 cells
Positive IHC detected inhuman tonsillitis tissue, human placenta tissue, human skin cancer tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14670-1-AP targets HLA-F in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6335

Product name: Recombinant human HLA-F protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-298 aa of BC062991

Sequence: AGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQS

Predict reactive species
Full Name major histocompatibility complex, class I, F
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberBC062991
Gene Symbol HLA-F
Gene ID (NCBI) 3134
RRIDAB_1519280
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP30511
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I and class II. This class I molecules are membrane glycoproteins composed of a heavy (alpha) chain which is encoded by a HLA class I gene, and β2-microglobulin light (beta) chain. The most extensively characterized members of the HLA class I gene family are the genes encoding the major transplantation antigenes, HLA-A, B and C. HLA-F is a non-classical MHC class I molecule. (PMID: 667938; 3375250; 2249951)

Protocols

Product Specific Protocols
IHC protocol for HLA-F antibody 14670-1-APDownload protocol
IP protocol for HLA-F antibody 14670-1-APDownload protocol
WB protocol for HLA-F antibody 14670-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratIHC

Kidney Int

Upregulation of HLA-F expression by BK polyomavirus infection induces immune recognition by KIR3DS1-positive natural killer cells.

Authors - Tobias F Koyro
humanIHC

Int J Cancer

Alteration of HLA-F and HLA I antigen expression in the tumor is associated with survival in patients with esophageal squamous cell carcinoma.

Authors - Zhang X X

J Immunol

Immune Modifications in Fetal Membranes Overlying the Cervix Precede Parturition in Humans.

Authors - Louis Marcellin
mouse,humanWB

Int J Biol Sci

Targeting HLA-F suppresses the proliferation of glioma cells via a reduction in hexokinase 2-dependent glycolysis.

Authors - Xin Chen
  • KD Validated
humanWB,IHC

Lung Cancer

HLA-F expression is a prognostic factor in patients with non-small-cell lung cancer.

Authors - Lin Aifen A
humanIHC

Oncol Lett

Lesion human leukocyte antigen-F expression is associated with a poor prognosis in patients with hepatocellular carcinoma.

Authors - Yongfu Xu
Loading...
||
New chat Able
正在加载,请稍候...