HMGA1 Polyclonal antibody

• 

HMGA1 Polyclonal Antibody for ELISA

Cat No. 15398-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, ELISA

Synonyms

HMG-I(Y), HMGA1A, High mobility group protein R, High mobility group protein HMG-I/HMG-Y, High mobility group protein A1

---

Published Applications

• WB: See 1 publications below

Product Information

15398-1-AP targets HMGA1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7613

  Product name: Recombinant human HMGA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-96 aa of BC004924

  Sequence: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

• Full Name: high mobility group AT-hook 1
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC004924
• Gene Symbol: HMGA1
• Gene ID (NCBI): 3159
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17096
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Hamster	WB	Lipids; The Safety and Anti-Hypercholesterolemic Effect of Coptisine in Syrian Golden Hamsters.; Authors - Kai He