HNRNPK Polyclonal antibody

• 

  WB analysis of MCF-7 using 11426-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11426-1-AP (HNRNPK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11426-1-AP

  IP result of anti-HNRNPK (IP:11426-1-AP, 4ug; Detection:11426-1-AP 1:1000) with HeLa cells lysate 2000ug.

• 

  IHC staining of human breast cancer using 11426-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11426-1-AP (HNRNPK antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11426-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11426-1-AP (HNRNPK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11426-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11426-1-AP (HNRNPK antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11426-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPK antibody (11426-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 11426-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using HNRNPK antibody (11426-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 11426-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human HNRNPK (11426-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

HNRNPK Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11426-1-AP

Publications(47)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, chIP, RIP, ELISA

Synonyms

TUNP, Transformation up-regulated nuclear protein, HNRPK, hnRNP K, FLJ41122

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 10 publications below
• WB: See 38 publications below
• IHC: See 5 publications below
• IF: See 12 publications below
• IP: See 4 publications below
• CoIP: See 3 publications below
• ChIP: See 1 publications below
• RIP: See 8 publications below

Product Information

11426-1-AP targets HNRNPK in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, chIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, chicken, deer
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1976

  Product name: Recombinant human HNRNPK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 114-463 aa of BC014980

  Sequence: LPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF

• Full Name: heterogeneous nuclear ribonucleoprotein K
• Calculated Molecular Weight: 463 aa, 51 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC014980
• Gene Symbol: HNRNPK
• Gene ID (NCBI): 3190
• RRID: AB_2264314
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61978
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HNRNPK belongs to the heterogeneous nuclear ribonucleoprotein family of 20 proteins that participate in a wide range of key cellular functions involving many of the pathways implicated, disrupted or dysregulated in tumor development and progression. It is also a conserved pre-mRNA-binding protein that is involved in multiple processes of gene expression, including chromatin remodeling, transcription, and mRNA splicing, translation, and stability.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; METTL3 regulates heterochromatin in mouse embryonic stem cells.; Authors - Wenqi Xu
human	WB	Cell; In vivo structural characterization of the SARS-CoV-2 RNA genome identifies host proteins vulnerable to repurposed drugs.; Authors - Lei Sun
human	WB	Cell Metab; NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.; Authors - Mi Kyung Park
	WB	Nat Commun; Profiling PRMT methylome reveals roles of hnRNPA1 arginine methylation in RNA splicing and cell growth.; Authors - Wen-Juan Li ; KD Validated
		Nat Commun; PRC1 collaborates with SMCHD1 to fold the X-chromosome and spread Xist RNA between chromosome compartments.; Authors - Chen-Yu Wang
		Nucleic Acids Res; Capturing RNA-protein interaction via CRUIS.; Authors - Ziheng Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

DEBJIT (Verified Customer) (09-17-2020)

WB: 1:2000IP: 2ug/mg cell lysate

• Applications: Western Blot, Immunoprecipitation
• Cell Tissue Type: Endothelial cells