HNRNPU Polyclonal antibody

• 

  WB analysis of HEK-293 using 16365-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16365-1-AP (HNRNPU antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16365-1-AP

  WB result of HNRNPU antibody (16365-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HNRNPU transfected HeLa cells.

• 

  WB analysis using 16365-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16365-1-AP (HNRNPU antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16365-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16365-1-AP (HNRNPU antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16365-1-AP

  IP result of anti-HNRNPU (IP:16365-1-AP, 4ug; Detection:16365-1-AP 1:8000) with HeLa cells lysate 2000 ug.

• 

  IHC staining of mouse kidney using 16365-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16365-1-AP (HNRNPU antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16365-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16365-1-AP (HNRNPU antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 16365-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using HNRNPU antibody (16365-1-AP) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using 16365-1-AP

  1X10^6 HepG2 cells were stained with 0.2ug HNRNPU antibody (16365-1-AP, red) and control antibody (blue). Cells were fixed with 4% PFA and permeabilized with 0.1% Triton X-100. Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) with dilution 1:1500.

• Featured Product
• KD/KO Validated

HNRNPU Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 16365-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

C1orf199, GRIP120, hnRNP U, HNRPU, Nuclear p120 ribonucleoprotein

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 4 publications below
• IP: See 2 publications below

Product Information

16365-1-AP targets HNRNPU in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9151

  Product name: Recombinant human HNRNPU protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 462-806 aa of BC003367

  Sequence: LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

• Full Name: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
• Calculated Molecular Weight: 91 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC003367
• Gene Symbol: HNRNPU
• Gene ID (NCBI): 3192
• RRID: AB_10596481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00839
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HNRNPU, also named as HNRPU, SAFA, and U21.1, is a 825 amino acid protein, which is extensively phosphorylated. HNRNPU as a component of ribonucleosomes localized in cytoplasmic mRNP granules containing untranslated mRNAs. HNRNPU is a component of the CRD-mediated complex that promotes MYC mRNA stabilization. HNRNPU Plays a role in the circadian regulation of the core clock component ARNTL/BMAL1 transcription. The calculated molecular weight of HNRNPU is 90 kDa, but the 120 kDa HNRNPU protein is an abundant nucleoplasmic phosphoprotein that can be crosslinked to pre-mRNA in intact cells by UV light (PMID: 1628625).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dev Cell; Genome-wide analysis of pseudogenes reveals HBBP1's human-specific essentiality in erythropoiesis and implication in β-thalassemia.; Authors - Yanni Ma
human	IF	Cancer Res; DIS3L2 promotes progression of hepatocellular carcinoma via hnRNP U-mediated alternative splicing.; Authors - Songge Xing
human	IP,IF	mSystems; Proteomic Profiling Identifies Kaposi's Sarcoma-Associated Herpesvirus (KSHV)-Encoded LANASIM-Associated Proteins in Hypoxia.; Authors - Xiaoqing Liu
		Cell Prolif; Protein phosphatase 4 plays dual roles during cell proliferation.; Authors - Xiuqing Huang
human	WB	J Exp Clin Cancer Res; A novel protein encoded by circHNRNPU promotes multiple myeloma progression by regulating the bone marrow microenvironment and alternative splicing.; Authors - Xiaozhu Tang ; KD Validated
human	WB,IHC	Front Oncol; The hnRNPK/A1/R/U Complex Regulates Gene Transcription and Translation and is a Favorable Prognostic Biomarker for Human Colorectal Adenocarcinoma.; Authors - Yixin Li