HOXB1 Polyclonal antibody, PBS Only

• 

  WB analysis using 21653-1-AP (same clone as 21653-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21653-1-AP (HOXB1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21653-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21653-1-AP (same clone as 21653-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21653-1-AP (HOXB1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21653-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21653-1-AP (same clone as 21653-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21653-1-AP (HOXB1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21653-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 21653-1-AP (same clone as 21653-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 21653-1-AP (HOXB1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21653-1-PBS in a different storage buffer formulation.

HOXB1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21653-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

homeobox B1, Homeobox protein Hox 2I, Homeobox protein Hox B1, Homeobox protein Hox-2I, Homeobox protein Hox-B1

---

Product Information

21653-1-PBS targets HOXB1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16366

  Product name: Recombinant human HOXB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC096192

  Sequence: MDYNRMNSFLEYPLCNRGPSAYSAHSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGHSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKE

• Full Name: homeobox B1
• Calculated Molecular Weight: 235 aa, 26 kDa
• Observed Molecular Weight: 32, 25 kDa
• GenBank Accession Number: BC096192
• Gene Symbol: HOXB1
• Gene ID (NCBI): 3211
• RRID: AB_2878899
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P14653
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HOXB1, also named as HOX2I, belongs to the Antp homeobox family and the Labial subfamily. HOXB1 is sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HOXB1 acts on the anterior body structures. Establishment of the spatial colinearity in the embryo is directly controlled by the Hox genes themselves. 21653-1-AP is a rabbit polyclonal antibody raised against residues near the N-terminus of human HOXB1.