HOXD3 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 10496-1-AP (same clone as 10496-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10496-1-AP (HOXD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10496-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 10496-1-AP (same clone as 10496-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using HOXD3 antibody (10496-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10496-1-PBS in a different storage buffer formulation.

HOXD3 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 10496-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10496-1-PBS targets HOXD3 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0768

  Product name: Recombinant human HOXD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC005124

  Sequence: MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLDTDYPGSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPPPPPPTLPPSSPTNPGGGVPAKKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATAGESCEDKSPPGPASKRVRTA

• Full Name: homeobox D3
• Calculated Molecular Weight: 46 kDa
• GenBank Accession Number: BC005124
• Gene Symbol: HOXD3
• Gene ID (NCBI): 3232
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31249
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Homeobox D3 (HOXD3), a member of the Homeobox (Hox) family of master transcription factors, is a homeobox transcription factor that promotes angiogenesis and collagen synthesis. HOXD3 is expressed during normal embryogenesis, skin development, and fetal wound healing (PMID: 14633614). The overexpression of HOXD3 plays a critical role in breast cancer stemness and drug resistance via integrin β3-mediated Wnt/β-catenin signaling (PMID: 29698974).