HPCAL4 Polyclonal antibody, PBS Only

• 

  WB analysis using 12470-1-AP (same clone as 12470-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12470-1-AP (HPCAL4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12470-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12470-1-AP (same clone as 12470-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12470-1-AP (HPCAL4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12470-1-PBS in a different storage buffer formulation.

• 

  IP experiment of fetal human brain using 12470-1-AP (same clone as 12470-1-PBS)

  IP result of anti-HPCAL4 (IP:12470-1-AP, 4ug; Detection:12470-1-AP 1:700) with fetal human brain tissue lysate 3200 ug. This data was developed using the same antibody clone with 12470-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human medulloblastoma using 12470-1-AP (same clone as 12470-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma using 12470-1-AP (HPCAL4 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12470-1-PBS in a different storage buffer formulation.

HPCAL4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12470-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12470-1-PBS targets HPCAL4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3153

  Product name: Recombinant human HPCAL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC030827

  Sequence: MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK

• Full Name: hippocalcin like 4
• Calculated Molecular Weight: 191 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC030827
• Gene Symbol: HPCAL4
• Gene ID (NCBI): 51440
• RRID: AB_2120231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UM19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.