HPCAL4 Polyclonal antibody

• 

  WB analysis using 12470-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12470-1-AP (HPCAL4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12470-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12470-1-AP (HPCAL4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of fetal human brain using 12470-1-AP

  IP result of anti-HPCAL4 (IP:12470-1-AP, 4ug; Detection:12470-1-AP 1:700) with fetal human brain tissue lysate 3200 ug.

• 

  IHC staining of human medulloblastoma using 12470-1-AP

  Immunohistochemical analysis of paraffin-embedded human medulloblastoma using 12470-1-AP (HPCAL4 antibody) at dilution of 1:100 (under 10x lens).

HPCAL4 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12470-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

Synonyms

hippocalcin like 4, Hippocalcin like protein 4, HLP4, HPCAL4

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, human brain tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: fetal human brain tissue
• Positive IHC detected in: human medulloblastoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12470-1-AP targets HPCAL4 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3153

  Product name: Recombinant human HPCAL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC030827

  Sequence: MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK

• Full Name: hippocalcin like 4
• Calculated Molecular Weight: 191 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC030827
• Gene Symbol: HPCAL4
• Gene ID (NCBI): 51440
• RRID: AB_2120231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UM19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.