HPCAL4 Polyclonal antibody

HPCAL4 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 12470-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

hippocalcin like 4, Hippocalcin like protein 4, HLP4, HPCAL4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, human brain tissue, mouse brain tissue, rat brain tissue
Positive IP detected infetal human brain tissue
Positive IHC detected inhuman medulloblastoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12470-1-AP targets HPCAL4 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3153

Product name: Recombinant human HPCAL4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-191 aa of BC030827

Sequence: MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK

Predict reactive species
Full Name hippocalcin like 4
Calculated Molecular Weight 191 aa, 22 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC030827
Gene Symbol HPCAL4
Gene ID (NCBI) 51440
RRIDAB_2120231
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UM19
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for HPCAL4 antibody 12470-1-APDownload protocol
IP protocol for HPCAL4 antibody 12470-1-APDownload protocol
WB protocol for HPCAL4 antibody 12470-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...