HPRT Monoclonal antibody, PBS Only

• 

  WB analysis using 67518-1-Ig (same clone as 67518-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67518-1-Ig (HPRT antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. HPRT deficient cell line Sp2/0 was served as a negative control. This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67518-1-Ig (same clone as 67518-1-PBS)

  WB result of HPRT antibody (67518-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HPRT transfected HEK-293 cells. This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67518-1-Ig (HPRT antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67518-1-Ig (same clone as 67518-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using HPRT antibody (67518-1-Ig, Clone: 1C3D1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67518-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HPRT Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67518-1-PBS

Clone No.1C3D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HPRT1, 1C3D1, EC:2.4.2.8, HGPRT, HGPRTase

---

Product Information

67518-1-PBS targets HPRT in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7044

  Product name: Recombinant human HPRT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-218 aa of BC000578

  Sequence: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA

• Full Name: hypoxanthine phosphoribosyltransferase 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC000578
• Gene Symbol: HPRT1
• Gene ID (NCBI): 3251
• RRID: AB_2882738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00492
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HPRT, also named HPRT1 and HGPRT, plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutation of HPRT1 is associated with Lesch-Nyhan syndrome (LNS) which is an X-linked inherited neurogenetic disorder of purine metabolism. It has been reported that HPRT1 also plays an important role in HPRT-related gout. 67518-1-Ig antibody detects the protein around 28 kDa in SDS-PAGE. And HPRT1 deficient cell line Sp2/0 was served as a negative control in PTG's results.(PMID:20544509, 28045594, 27379977)