HRH1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Cytometric bead array sample test of MP03173-1

  The mean HRH1 concentration was determined to be 12.9 ng/mL in U-87MG cell extract based on a 1.2 mg/mL extract load, 19.5 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load, 3.0 ng/mL in Ramos cell extract based on a 1.5 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP03173-1

  Cytometric bead array standard curve of MP03173-1, HRH1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87723-2-PBS. Detection antibody: 87723-1-PBS. Standard: Ag30464. Range: 0.625-80 ng/mL.

HRH1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87723-2-PBS

Clone No.253277A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

H1 R, H1R, HH1R, hisH1, Histamine H1 receptor

---

Product Information

87723-2-PBS targets HRH1 as part of a matched antibody pair:

MP03173-1: 87723-2-PBS capture and 87723-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30464

  Product name: Recombinant human HRH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-416 aa of BC060802

  Sequence: LDIEHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

• Full Name: histamine receptor H1
• Calculated Molecular Weight: 487 aa, 56 kDa
• GenBank Accession Number: BC060802
• Gene Symbol: HRH1
• Gene ID (NCBI): 3269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35367
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.