ERAB Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ERAB Polyclonal antibody (10648-1-AP)

• Featured Product
• KD/KO Validated

ERAB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10648-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA
For FC, select conjugated version.

Synonyms

HSD17B10, 17-beta-estradiol 17-dehydrogenase, 2-methyl-3-hydroxybutyryl-CoA dehydrogenase, 3-alpha-(17-beta)-hydroxysteroid dehydrogenase, 3alpha(or 20beta)-hydroxysteroid dehydrogenase

• 

  WB analysis of HEK-293 using 10648-1-AP

  WB result of ERAB antibody (10648-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERAB transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10648-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 10648-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10648-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10648-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A2780 using 10648-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 10648-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10648-1-AP

  IP result of anti-ERAB (IP:10648-1-AP, 4ug; Detection:10648-1-AP 1:500) with HeLa cells lysate 1200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10648-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10648-1-AP (ERAB antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 10648-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10648-1-AP (ERAB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 10648-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ERAB antibody (10648-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 10648-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ERAB antibody (10648-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 10648-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug ERAB Polyclonal antibody (10648-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ERAB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue, HEK-293 cells, A2780 cells, mouse liver tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10648-1-AP targets ERAB in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1020

  Product name: Recombinant human HSD17B10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-252 aa of BC008708

  Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

• Full Name: hydroxysteroid (17-beta) dehydrogenase 10
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008708
• Gene Symbol: ERAB
• Gene ID (NCBI): 3028
• RRID: AB_2264270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).

Publications

What published studies show

The ERAB anti-HSD17B10 polyclonal antibody (Cat# 10648-1-AP) has 12 citations. These appear in journals including Circulation, Neuron, Cell Reports, Journal of Biological Chemistry, Human Molecular Genetics, Endocrinology, Phytotherapy Research, Food and Chemical Toxicology, General and Comparative Endocrinology, Journal of Oleo Science, and Environmental Health. Research fields span heart failure, autophagy and alpha-synuclein, diabetic kidney disease, mitochondrial ribosome assembly, lipid droplet accumulation and cognition, adipocyte fat storage, vascular smooth muscle, renal energy metabolism, Leber's hereditary optic neuropathy, thymic remodeling, skeletal muscle metabolism, and hepatotoxicity.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Circulation; Stimulates Short-Chain Dehydrogenase/Reductase Proteins to Alleviate Heart Failure Independent of Mitochondrial Protein Deacetylation; Authors - Matthew A Walker
		Neuron; Alpha-synuclein mutations mislocalize cytoplasmic p300 compromising autophagy, which is rescued by ACLY inhibition; Authors - Sung Min Son
mouse,human	WB,IP	Phytother Res; Astragaloside IV protects renal tubular epithelial cells against oxidative stress-induced injury by upregulating CPT1A-mediated HSD17B10 lysine succinylation in diabetic kidney disease; Authors - Meng Wang
mouse	WB	Cell Rep; Hierarchical RNA Processing Is Required for Mitochondrial Ribosome Assembly.; Authors - Oliver Rackham
		Cell Rep; High glucose impairs cognitive function by inducing lipid droplet accumulation through lactylation of HSD17B10 at K105.; Authors - Jingxi Xu
mouse	WB,RIP	J Biol Chem; RNase P generated tRF(Ser-GCT) promotes fat storage in adipocytes via Adrb2 signaling.; Authors - Linyuan Shen ; KD Validated