ERAB Polyclonal antibody

• 

  WB analysis of HEK-293 using 10648-1-AP

  WB result of ERAB antibody (10648-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ERAB transfected HEK-293 cells.

• 

  WB analysis of HeLa using 10648-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 10648-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A2780 using 10648-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 10648-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10648-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10648-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10648-1-AP (ERAB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 10648-1-AP

  IP result of anti-ERAB (IP:10648-1-AP, 4ug; Detection:10648-1-AP 1:500) with HeLa cells lysate 1200ug.

• 

  IHC staining of human breast cancer using 10648-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10648-1-AP (ERAB antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of mouse brain using 10648-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10648-1-AP (ERAB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 10648-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ERAB antibody (10648-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of MCF-7 using 10648-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ERAB antibody (10648-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  FC experiment of MCF-7 using 10648-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug ERAB Polyclonal antibody (10648-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

ERAB Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10648-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HSD17B10, 17-beta-estradiol 17-dehydrogenase, 2-methyl-3-hydroxybutyryl-CoA dehydrogenase, 3-alpha-(17-beta)-hydroxysteroid dehydrogenase, 3alpha(or 20beta)-hydroxysteroid dehydrogenase

---

Tested Applications

• Positive WB detected in: HeLa cells, human brain tissue, HEK-293 cells, A2780 cells, mouse liver tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IP: See 1 publications below

Product Information

10648-1-AP targets ERAB in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1020

  Product name: Recombinant human HSD17B10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-252 aa of BC008708

  Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

• Full Name: hydroxysteroid (17-beta) dehydrogenase 10
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC008708
• Gene Symbol: ERAB
• Gene ID (NCBI): 3028
• RRID: AB_2264270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99714
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSD17B10 (3-hydroxyacyl-CoA dehydrogenase type-2) is a multifunctional mitochondrial enzyme that acts on a wide spectrum of substrates, including neuroactive steroids, alcohols, leucine, and fatty acids, with a preference for short-chain methyl-branched acyl-CoAs(PMID:15860413).It has 2 isoforms produced by alternative splicing.Defects in HSD17B10 are the cause of 2-methyl-3-hydroxybutyryl-CoA dehydrogenase deficiency (MHBD deficiency) and mental retardation syndromic X-linked type 10 (MRXS10).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; Hierarchical RNA Processing Is Required for Mitochondrial Ribosome Assembly.; Authors - Oliver Rackham
human	WB	Hum Mol Genet; Leber's hereditary optic neuropathy (LHON)-associated ND6 14 484 T > C mutation caused pleiotropic effects on the complex I, RNA homeostasis, apoptosis and mitophagy.; Authors - Min Liang
mouse	WB	Endocrinology; Wnt16 Promotes Vascular Smooth Muscle Contractile Phenotype and Function via Taz (Wwtr1) Activation in Male LDLR-/- Mice; Authors - Abraham Behrmann
rat	WB	J Oleo Sci; Effects of Dietary Fat Restriction on Endurance Training-induced Metabolic Adaptations in Rat Skeletal Muscle.; Authors - Takuya Karasawa
mouse,human	WB,IP	Phytother Res; Astragaloside IV protects renal tubular epithelial cells against oxidative stress-induced injury by upregulating CPT1A-mediated HSD17B10 lysine succinylation in diabetic kidney disease; Authors - Meng Wang
mouse	WB	Circulation; Stimulates Short-Chain Dehydrogenase/Reductase Proteins to Alleviate Heart Failure Independent of Mitochondrial Protein Deacetylation; Authors - Matthew A Walker