Tested Applications
| Positive WB detected in | mouse liver tissue, mouse brain tissue, mouse heart tissue, HepG2 cells, rat liver tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human prostate cancer tissue, mouse liver tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15116-1-AP targets HSD17B4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7165 Product name: Recombinant human HSD17B4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 436-736 aa of BC003098 Sequence: GSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL Predict reactive species |
| Full Name | hydroxysteroid (17-beta) dehydrogenase 4 |
| Calculated Molecular Weight | 80 kDa |
| Observed Molecular Weight | 80 kDa, 45 kDa |
| GenBank Accession Number | BC003098 |
| Gene Symbol | HSD17B4 |
| Gene ID (NCBI) | 3295 |
| RRID | AB_2119959 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51659 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HSD17B4 (17-beta-hydroxysteroid dehydrogenase 4) is also named as Peroxisomal multifunctional enzyme type 2, D-bifuntional protein or multifunctional protein 2. It codes for a 80 kDa enzyme containing three distinct functional domains and is localized in peroxisomes. It is a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids and catalyzing the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-brancked-chian fatty acids. After peroxisomal import, the full-length protein is proteolytically cleaved to yield a 35-kDa dehydrogenase subunit and a 45-kDa hydratase subunit containing the hydratase and SCP domains (PMID: 28868548, 24602372).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HSD17B4 antibody 15116-1-AP | Download protocol |
| IHC protocol for HSD17B4 antibody 15116-1-AP | Download protocol |
| IP protocol for HSD17B4 antibody 15116-1-AP | Download protocol |
| WB protocol for HSD17B4 antibody 15116-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The HSD17B4 Polyclonal antibody (Cat# 15116-1-AP) has 24 citations. These appear in journals including Nature Communications, Phytomedicine, Molecular Medicine, Molecular Cells, Cell Reports, Biomedical Pharmacotherapy, Journal of Ethnopharmacology, Cells, Neurobiology of Disease, Communications Biology, Scientific Reports, Experimental Neurology, Molecular and Cellular Biochemistry, Biology, BMC Genomics, Journal of Biomedical Research, Kidney360, Cell Biochemistry and Function, 3 Biotech, PLoS One, Biochemical and Biophysical Research Communications, Biochimica et Biophysica Acta, OncoTargets and Therapy, and bioRxiv. Research fields span peroxisomal biology, lipid metabolism, steroidogenesis, reproductive disorders, neurodegeneration, and cancer.
| Species | Application | Title |
|---|---|---|
Nat Commun HSD17B4 deficiency causes dysregulation of primary cilia and is alleviated by acetyl-CoA | ||
Phytomedicine Morus alba L. (Sangzhi) alkaloids reduce polycystic ovary syndrome by improving hypothalamic-pituitary-ovarian axis function.
| ||
Mol Med The downregulation of hormone-sensitive lipase and dysregulation of cholesterol receptors/transporter affect testicular lipid homeostasis and function in HFD-induced oligoasthenospermia mice | ||
Mol Cells The Peroxisomal Localization of Hsd17b4 Is Regulated by Its Interaction with Phosphatidylserine. | ||
Cell Rep High glucose impairs cognitive function by inducing lipid droplet accumulation through lactylation of HSD17B10 at K105. | ||
Biomed Pharmacother Apigenin improves testosterone synthesis by regulating endoplasmic reticulum stress |
