HSF1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67189-1-Ig (same clone as 67189-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67189-1-Ig (HSF1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67189-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67189-1-Ig (same clone as 67189-1-PBS)

  WB result of HSF1 antibody (67189-1-Ig; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-HSF1 transfected HeLa cells. This data was developed using the same antibody clone with 67189-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67189-1-Ig (same clone as 67189-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67189-1-Ig (HSF1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67189-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67189-1-Ig (same clone as 67189-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67189-1-Ig (HSF1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67189-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67189-1-Ig (same clone as 67189-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67189-1-Ig (HSF1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67189-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67189-1-Ig (same clone as 67189-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67189-1-Ig (HSF1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67189-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

HSF1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67189-1-PBS

Clone No.1F10A5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Heat shock factor protein 1, HSF 1, HSF1, HSTF 1, HSTF1

---

Product Information

67189-1-PBS targets HSF1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29061

  Product name: Recombinant human HSF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 230-529 aa of BC014638

  Sequence: SLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

• Full Name: heat shock transcription factor 1
• Calculated Molecular Weight: 529 aa, 57 kDa
• Observed Molecular Weight: 68-80 kDa
• GenBank Accession Number: BC014638
• Gene Symbol: HSF1
• Gene ID (NCBI): 3297
• RRID: AB_2882484
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q00613
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HSF1 belongs to heat-shock transcription factors that activate heat-shock response genes under conditions of heat or other stresses. Also, HSF1 has been linked with oogenesis, spermatogenesis, and placental development. It can activate AKT and inactivate JNK and CASP3 to protect cardiomyocytes from death. And it has a role in the regulation of life span and establishes a role for SIRT1 in protein homeostasis and heat-shock response. The calculated molecular weight of HSF1 is 57 kDa, but HSF1 migrates at approximately 80 kDa which likely represents different phosphorylation states (PMID: 18434628).