• Featured Product
  • KD/KO Validated

HSF1 Monoclonal antibody, PBS Only

HSF1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67189-1-PBS
Clone No.1F10A5

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Heat shock factor protein 1, HSF 1, HSF1, HSTF 1, HSTF1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67189-1-PBS targets HSF1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29061

Product name: Recombinant human HSF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 230-529 aa of BC014638

Sequence: SLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

Predict reactive species
Full Name heat shock transcription factor 1
Calculated Molecular Weight 529 aa, 57 kDa
Observed Molecular Weight 68-80 kDa
GenBank Accession NumberBC014638
Gene Symbol HSF1
Gene ID (NCBI) 3297
RRIDAB_2882484
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ00613
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HSF1 belongs to heat-shock transcription factors that activate heat-shock response genes under conditions of heat or other stresses. Also, HSF1 has been linked with oogenesis, spermatogenesis, and placental development. It can activate AKT and inactivate JNK and CASP3 to protect cardiomyocytes from death. And it has a role in the regulation of life span and establishes a role for SIRT1 in protein homeostasis and heat-shock response. The calculated molecular weight of HSF1 is 57 kDa, but HSF1 migrates at approximately 80 kDa which likely represents different phosphorylation states (PMID: 18434628).

Loading...
||
New chat Able
正在加载,请稍候...