HSF4 Polyclonal antibody

HSF4 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 22883-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

HSTF 4, HSF 4, hHSF4, Heat shock factor protein 4, CTM

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human brain tissue, mouse brain tissue, mouse lung tissue, rat brain tissue, mouse heart tissue, mouse skeletal muscle tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

22883-1-AP targets HSF4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18935

Product name: Recombinant human HSF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 340-462 aa of BC153061

Sequence: DRSPESLLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSPGKDPTLGAPLLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASPSP

Predict reactive species
Full Name heat shock transcription factor 4
Calculated Molecular Weight 492 aa, 53 kDa
Observed Molecular Weight 62-66 kDa
GenBank Accession NumberBC153061
Gene Symbol HSF4
Gene ID (NCBI) 3299
RRIDAB_2879184
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ9ULV5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prokaryotic and eukaryotic cells respond to thermal and chemical stress by inducing a group of genes collectively designated heat shock genes. In eukaryotes, this gene expression is regulated primarily at the transcriptionlevel. Heat shock transcription factors (HSF, also designated HSTF) 1 and 2 are involved in this regulation. HSF1 and HSF2 are upregulated by estrogen, at both the mRNA and protein level. HSF1 is normally found as a monomer, whose transcriptional activity is repressed by constitutive phosphorylation. Upon activation, HSF1 forms trimers, gains DNA binding activity and is translocated to the nucleus. HSF2 activity is associated with differentiation and development, and, like HSF1, binds DNA as a trimer. HSF4 exists as two splice variants and is expressed in heart, brain and skeletal muscle as a homotrimer. HSF4a does not contain a DNA-binding domain and inhibits the formation of HSF1 nuclear bodies, thus repressing HSF1 mediated transcription. HSF4b does contain a DNA-binding domain and colocalizes with HSF1 nuclear bodies after heat shock. This antibody is specific to human HSF4.

Protocols

Product Specific Protocols
WB protocol for HSF4 antibody 22883-1-APDownload protocol
IHC protocol for HSF4 antibody 22883-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Exp Eye Res

Genetic mutation in HSF4 is associated with retinal degeneration in mice

Authors - Baixue Liu
Loading...
||
New chat Able
正在加载,请稍候...