Tested Applications
| Positive WB detected in | HEK-293 cells, MCF-7 cells, PC-12 cells, HeLa cells, NIH/3T3 cells, U-87 MG cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human ovary tumor tissue, human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10654-1-AP targets Hsc70 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, goat, c.elegans |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1018 Product name: Recombinant human Hsc70 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 288-587 aa of BC007276 Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD Predict reactive species |
| Full Name | heat shock 70kDa protein 8 |
| Calculated Molecular Weight | 70 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC007276 |
| Gene Symbol | HSC70 |
| Gene ID (NCBI) | 3312 |
| RRID | AB_2120153 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11142 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease (21832061). In addition, this antibody is most likely able to recognize Hsp70.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Hsc70 antibody 10654-1-AP | Download protocol |
| IHC protocol for Hsc70 antibody 10654-1-AP | Download protocol |
| WB protocol for Hsc70 antibody 10654-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Hsc70 polyclonal antibody (Cat# 10654-1-AP) has accumulated 153 citations across diverse high-impact journals including Nature, Nat Commun, Nat Cancer, Cell Death Dis, Autophagy, Cancer Res, J Extracell Vesicles, PNAS, Oncogene, and Cell Rep. Research fields span chaperone-mediated autophagy, ferroptosis, oncology (breast, liver, lung, gastric, bladder cancers), neurodegeneration (Parkinson's, tauopathy), cardiology, immunology/inflammation, virology, metabolic diseases, fibrosis, and cellular senescence.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Albumosomes formed by cytoplasmic pre-folding albumin maintain mitochondrial homeostasis and inhibit nonalcoholic fatty liver disease | ||
Mol Cancer o8G-modified circPLCE1 inhibits lung cancer progression via chaperone-mediated autophagy | ||
Nat Cancer SCRN1 confers hepatocellular carcinoma resistance to ferroptosis by stabilizing GPX4 via STK38-mediated phosphorylation. | ||
Cancer Res HBx-induced HSPA8 stimulates HBV replication and suppresses ferroptosis to support liver cancer progression
|
Reviews
What customers say
Both reviewers gave 5-star ratings for Western Blot applications. One user reported a very strong and specific Hsc70 band at ~70 kDa in heart tissue (1:1000 dilution), calling it one of the best antibodies they've used for Hsp70 family proteins. The other user confirmed clear detection of HSC70 expression in H4 cells at the same 1:1000 dilution. Overall, users highlight excellent specificity and strong signal for HSC70 detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tongbin (Verified Customer) (08-25-2020) | I had a very strong and specific Hsc70 band at ~70 kDa. Definitely one of the best antibodies I have used for Hsp70 family proteins.
 |
Mayur (Verified Customer) (04-30-2019) | Great antibody. Detects the HSC70 expression in the H4 cells very clearly.
 |
