Hsc70 Polyclonal antibody

• 

  WB analysis using 10654-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10654-1-AP (Hsc70 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10654-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10654-1-AP (Hsc70 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10654-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10654-1-AP (Hsc70 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10654-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10654-1-AP (Hsc70 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human renal cell carcinoma using 10654-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 10654-1-AP (Hsc70 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 10654-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 10654-1-AP (Hsc70 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10654-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10654-1-AP (Hsc70 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 10654-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 10654-1-AP (Hsc70 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 10654-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HEK-293 cells using Hsc70 antibody (10654-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Hsc70 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 10654-1-AP

Publications(94)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

Synonyms

HSPA8, EC:3.6.4.10, Heat shock cognate 71 kDa protein, Heat shock protein family A member 8, HSP73

---

Tested Applications

• Positive WB detected in: HEK-293 cells, MCF-7 cells, PC-12 cells, HeLa cells, NIH/3T3 cells, U-87 MG cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human ovary tumor tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 14 publications below
• WB: See 74 publications below
• IHC: See 7 publications below
• IF: See 18 publications below
• IP: See 8 publications below
• CoIP: See 9 publications below
• RIP: See 1 publications below

Product Information

10654-1-AP targets Hsc70 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1018

  Product name: Recombinant human Hsc70 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 288-587 aa of BC007276

  Sequence: QKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD

• Full Name: heat shock 70kDa protein 8
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC007276
• Gene Symbol: HSC70
• Gene ID (NCBI): 3312
• RRID: AB_2120153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11142
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPA8 (also known as HSC70) is a member of the HSPA (HSP70) family of heat-shock proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA8 is a constitutively expressed cytosol/nuclear protein able to translocate between cytoplasm and nucleus. Recently it has been reported that HSPA8 can interact with α-synuclein, the critical pathological protein of Parkinson's disease, indicating its implication in neurodegenerative disease (21832061). In addition, this antibody is most likely able to recognize Hsp70.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A dominant autoinflammatory disease caused by non-cleavable variants of RIPK1.; Authors - Panfeng Tao
		Mol Cell; A pro-metastatic tRNA fragment drives Nucleolin oligomerization and stabilization of its bound metabolic mRNAs.; Authors - Xuhang Liu
		J Extracell Vesicles; Human bronchial epithelial cell-derived extracellular vesicle therapy for pulmonary fibrosis via inhibition of TGF-β-WNT crosstalk.; Authors - Tsukasa Kadota
mouse	WB	Cell Rep Med; Targeting phenylpyruvate restrains excessive NLRP3 inflammasome activation and pathological inflammation in diabetic wound healing; Authors - Dongming Lv
human	WB	Nat Chem Biol; PSAT1 impairs ferroptosis and reduces immunotherapy efficacy via GPX4 hydroxylation; Authors - Peixiang Zheng
	WB	Sci Adv; ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution; Authors - Michael J McKenna

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tongbin (Verified Customer) (08-25-2020)

I had a very strong and specific Hsc70 band at ~70 kDa. Definitely one of the best antibodies I have used for Hsp70 family proteins.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Heart

Hsc70 Antibody Western Blot validation (1:1000 dilution) in Heart (Cat no:10654-1-AP)

FH

Mayur (Verified Customer) (04-30-2019)

Great antibody. Detects the HSC70 expression in the H4 cells very clearly.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: H4

Hsc70 Antibody Western Blot, validation (1:1000 dilution) in H4 (Cat no:10654-1-AP)