Tested Applications
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
23561-1-AP targets HTR6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15396 Product name: Recombinant human HTR6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 311-440 aa of BC074996 Sequence: CNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNFFNIDPAEPELRPHPLGIPTN Predict reactive species |
Full Name | 5-hydroxytryptamine (serotonin) receptor 6 |
Calculated Molecular Weight | 440 aa, 47 kDa |
GenBank Accession Number | BC074996 |
Gene Symbol | HTR6 |
Gene ID (NCBI) | 3362 |
RRID | AB_2879296 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | P50406 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for HTR6 antibody 23561-1-AP | Download protocol |
IF protocol for HTR6 antibody 23561-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |