HTR6 Polyclonal antibody

• 

  IHC staining of human brain using 23561-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23561-1-AP (HTR6 Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 23561-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23561-1-AP (HTR6 Antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of mouse brain using 23561-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse brain using 23561-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of rat brain using 23561-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of rat brain using 23561-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using HTR6 antibody (23561-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

HTR6 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 23561-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

5-HT-6, 5-HT6, 5 hydroxytryptamine receptor 6, 5 HT6R, 5 HT6

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

23561-1-AP targets HTR6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15396

  Product name: Recombinant human HTR6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 311-440 aa of BC074996

  Sequence: CNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNFFNIDPAEPELRPHPLGIPTN

• Full Name: 5-hydroxytryptamine (serotonin) receptor 6
• Calculated Molecular Weight: 440 aa, 47 kDa
• GenBank Accession Number: BC074996
• Gene Symbol: HTR6
• Gene ID (NCBI): 3362
• RRID: AB_2879296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P50406
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cureus; Possible Role of 5-Hydroxytryptamine (5-HT) Receptor on Human Sperm Motility Regulation; Authors - Maya Omote