HURP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86704-1-RR (same clone as 86704-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86704-1-RR (HURP antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86704-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86704-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86704-1-RR against Human HURP were performed. The affinity constant is 3.84 nM.

HURP Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86704-1-PBS

Clone No.251623E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

DAP-5, Discs large homolog 7, Disks large-associated protein 5, Disks large-associated protein DLG7, DLG7

---

Product Information

86704-1-PBS targets HURP in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2667

  Product name: Recombinant human HURP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 498-847 aa of BC010658

  Sequence: IKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF

• Full Name: discs, large (Drosophila) homolog-associated protein 5
• Calculated Molecular Weight: 846 aa, 95 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC010658
• Gene Symbol: HURP
• Gene ID (NCBI): 9787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15398
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.