HVCN1 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of Raji using 66449-1-Ig (same clone as 66449-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66449-1-Ig (HVCN1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66449-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66449-1-Ig (same clone as 66449-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66449-1-Ig (HVCN1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66449-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66449-1-Ig (same clone as 66449-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66449-1-Ig (HVCN1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66449-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66449-1-Ig (same clone as 66449-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66449-1-Ig (HVCN1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66449-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66449-1-Ig (same clone as 66449-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using HVCN1 antibody (66449-1-Ig, Clone: 1E4C4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66449-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human tonsillitis using 66449-1-Ig (same clone as 66449-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using HVCN1 antibody (66449-1-Ig, Clone: 1E4C4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66449-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51480-1

  Cytometric bead array sample test of MP51480-1, HVCN1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66449-1-PBS. Detection antibody: 66449-2-PBS.

• 

  Cytometric bead array standard curve of MP51480-1

  Cytometric bead array standard curve of MP51480-1, HVCN1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66449-1-PBS. Detection antibody: 66449-2-PBS. Standard:Ag5350. Range: 0.781-100 ng/mL.

HVCN1 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 66449-1-PBS

Clone No.1E4C4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

1E4C4, HV1, Hydrogen voltage-gated channel 1, UNQ578/PRO1140, Voltage sensor domain-only protein

---

Product Information

66449-1-PBS targets HVCN1 as part of a matched antibody pair:

MP51480-1: 66449-1-PBS capture and 66449-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5350

  Product name: Recombinant human HVCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-103 aa of BC032672

  Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQV

• Full Name: hydrogen voltage-gated channel 1
• Calculated Molecular Weight: 273 aa, 32 kDa
• Observed Molecular Weight: 28-35 kDa, 40 kDa, 60 kDa
• GenBank Accession Number: BC032672
• Gene Symbol: HVCN1
• Gene ID (NCBI): 84329
• RRID: AB_2881818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96D96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

HVCN1, also named as VSOP and HV1, Belongs to the hydrogen channel family. HVCN1 mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, HVCN1 is accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis. HVCN1, the voltage-sensitive proton channel, is present in human sperm and is an important regulator of the functional maturation of sperm. HVCN1 has four isoforms with MW 28-32 kDa or 40 kDa (modification). It has a dimer form with MW 60 kDa.