HVCN1 Monoclonal antibody, PBS Only (Capture)

HVCN1 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66449-1-PBS
Clone No.1E4C4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

1E4C4, HV1, Hydrogen voltage-gated channel 1, UNQ578/PRO1140, Voltage sensor domain-only protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66449-1-PBS targets HVCN1 as part of a matched antibody pair:

MP51480-1: 66449-1-PBS capture and 66449-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5350

Product name: Recombinant human HVCN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC032672

Sequence: MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAAAPDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQV

Predict reactive species
Full Name hydrogen voltage-gated channel 1
Calculated Molecular Weight 273 aa, 32 kDa
Observed Molecular Weight 28-35 kDa, 40 kDa, 60 kDa
GenBank Accession NumberBC032672
Gene Symbol HVCN1
Gene ID (NCBI) 84329
RRIDAB_2881818
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96D96
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HVCN1, also named as VSOP and HV1, Belongs to the hydrogen channel family. HVCN1 mediates the voltage-dependent proton permeability of excitable membranes. It forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, HVCN1 is accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis. HVCN1, the voltage-sensitive proton channel, is present in human sperm and is an important regulator of the functional maturation of sperm. HVCN1 has four isoforms with MW 28-32 kDa or 40 kDa (modification). It has a dimer form with MW 60 kDa.

Loading...
||
New chat Able
正在加载,请稍候...