HYAL1 Polyclonal antibody, PBS Only

HYAL1 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 25179-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

25179-1-PBS targets HYAL1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17943

Product name: Recombinant human HYAL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 131-435 aa of BC035695

Sequence: EAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW

Predict reactive species
Full Name hyaluronoglucosaminidase 1
Calculated Molecular Weight 435 aa, 48 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC035695
Gene Symbol HYAL1
Gene ID (NCBI) 3373
RRIDAB_2879945
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12794
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Hyaluronic acid (HA) is a glycosaminoglycan that is believed to have numerous important biologic functions, including modulation of cell proliferation, migration, and differentiation, as well as the regulation of extracellular water and protein homeostasis. It is also an integral structural component of cartilage and other tissues and acts as a lubricant in joints. Hyaluronidases are a family of enzymes that catalyse the degradation of HA. In humans, there are five functional hyaluronidases: HYAL1, HYAL2, HYAL3, HYAL4 and HYAL5 (also known as SPAM1 or PH-20); plus a pseudogene, HYAL6 (also known as HYALP1). HYAL-1 is present in many tissues and is predominantly found in the plasma and urine (PMID: 16600643). In addition to its function in normal cellular hyaluronan turnover, human HYAL-1 is implicated in cancer proliferation, angiogenesis, and inflammatory diseases (PMID: 17503783).

Loading...
||
New chat Able
正在加载,请稍候...