• Featured Product
  • KD/KO Validated

CoraLite®488-conjugated IFIH1 Polyclonal antibody

IFIH1 Polyclonal Antibody for IF-P
Cat No. CL488-21775

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

MDA5, Interferon-induced helicase C domain-containing protein 1, IFIH 1, Helicard, EC:3.6.4.13

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21775 targets IFIH1 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16467

Product name: Recombinant human IFIH1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-310 aa of BC111750

Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRP

Predict reactive species
Full Name interferon induced with helicase C domain 1
Calculated Molecular Weight 1025 aa, 117 kDa
Observed Molecular Weight117-125 kDa
GenBank Accession NumberBC111750
Gene Symbol IFIH1
Gene ID (NCBI) 64135
RRIDAB_2883087
Conjugate CoraLite®488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths491 nm / 516 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BYX4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IFIH1 (Interferon-induced helicase C domain-containing protein 1) is a putative RNA helicase that is upregulated in response to treatment with IFNB or IFNB and MEZ. It is also named as MDA5 and RH116. Ectopic expression of MDA5 in melanoma cells resulted in reduced colony formation, suggesting an interaction of the CARD and apoptotic signal molecules. Functional analysis indicated that MDA5 is an RNA-dependent ATPase. And this anitbody is CL488(Ex/Em 488 nm/515 nm) conjugated.

Protocols

Product Specific Protocols
IF protocol for CL488 IFIH1 antibody CL488-21775Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...