• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated IFITM2/3 Monoclonal antibody

IFITM2/3 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66081
Clone No.2E8D12

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

IFITM3, 1 8U, 2E8D12, DSPA2b, Interferon-induced transmembrane protein 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66081 targets IFITM2/3 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17863

Product name: Recombinant human IFITM3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-133 aa of BC006794

Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

Predict reactive species
Full Name interferon induced transmembrane protein 3 (1-8U)
Observed Molecular Weight 14 kDa
GenBank Accession NumberBC070243
Gene Symbol IFITM3
Gene ID (NCBI) 10410
RRIDAB_2919945
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01628
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

IFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome. IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. This antibody recognizes both IFITM2 and IFITM3.

Protocols

Product Specific Protocols
FC protocol for CL594 IFITM2/3 antibody CL594-66081Download protocol
IF protocol for CL594 IFITM2/3 antibody CL594-66081Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...