Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IFITM2/3 Monoclonal antibody

IFITM2/3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66081-1-Ig
Clone No. 2E8D12
Publications (25)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

IFITM3, 1 8U, 2E8D12, DSPA2b, Interferon-induced transmembrane protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IFITM2/3 in ?

Tested Applications

Positive WB detected inU2OS cells, THP-1 cells, HL-60 cells, K-562 cells, Jurkat cells, MCF-7 cells, HeLa cells, LNCaP cells, A549 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66081-1-Ig targets IFITM2/3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17863

Product name: Recombinant human IFITM3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-133 aa of BC006794

Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG

Predict reactive species
Full Name interferon induced transmembrane protein 3 (1-8U)
Observed Molecular Weight 15-20 kDa
GenBank Accession NumberBC070243
Gene Symbol IFITM3
Gene ID (NCBI) 10410
RRIDAB_11182821
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01628
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome. IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. This antibody recognizes both IFITM2 and IFITM3.

Protocols

Product Specific Protocols
IF protocol for IFITM2/3 antibody 66081-1-IgDownload protocol
IHC protocol for IFITM2/3 antibody 66081-1-IgDownload protocol
WB protocol for IFITM2/3 antibody 66081-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IFITM3 antibody (Cat# 66081-1-Ig) has 25 citations across journals including Science, Nature Communications, EMBO Journal, PNAS, Science Advances, Frontiers in Immunology, mBio, Journal of Virology, and others. Research fields span virology (HIV, influenza, SARS-CoV-2, Hantaan virus, CMV), innate immunity and interferon signaling, endosomal membrane trafficking, syncytia formation, gene therapy, and tumor immune microenvironment studies.

SpeciesApplicationTitle
human

Science

IFITM proteins inhibit placental syncytiotrophoblast formation and promote fetal demise.

Authors - Julian Buchrieser
humanIF

Nat Commun

Omicron Spike confers enhanced infectivity and interferon resistance to SARS-CoV-2 in human nasal tissue

Authors - Guoli Shi
human

Sci Adv

Restriction of HIV-1 infectivity by interferon and IFITM3 is counteracted by Nef.

Authors - Mahesh Agarwal
humanWB,IF

Proc Natl Acad Sci U S A

mTOR inhibitors lower an intrinsic barrier to virus infection mediated by IFITM3.

Authors - Guoli Shi
WB

EMBO J

Immune surveillance of brain metastatic cancer cells is mediated by IFITM1

Authors - Xiaofei She
humanWB

EMBO J

SNARE mimicry by the CD225 domain of IFITM3 enables regulation of homotypic late endosome fusion

Authors - Kazi Rahman

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Claudia C., 2022) gave this antibody a 5-star rating, reporting excellent performance for both Western blot (1:5000) and immunofluorescence (1:200) when analyzing IFITM2/3 expression in permanent cell lines. The antibody was described as working "very well" for these applications. Overall, the single review reflects a positive experience with strong results across two techniques.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Claudia (Verified Customer) (06-20-2022)

The antibody worked very well for the analysis of IFITM2/3 expression in permanent cell lines.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200 (immunofluorescence), 1:5000 (Western blot)
  • Cell Tissue Type: Permanent cell lines
Loading...
||
New chat

Able™

正在加载,请稍候...