Anti-Mouse IFN-beta Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98082-1-RR (same clone as 98082-1-PBS)

  1x10^6 mouse splenocytes were intracellularly stained with 0.25 ug Anti-Mouse IFN-beta Rabbit Recombinant Antibody (98082-1-RR, Clone:240230B6) or isotype control and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). Cells were stained with CoraLite® Plus 647 Anti-Mouse CD19 before fixing. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98082-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98082-1-RR (same clone as 98082-1-PBS)

  1x10^6 mouse splenocytes were intracellularly stained with 0.25 ug Anti-Mouse IFN-beta Rabbit Recombinant Antibody (98082-1-RR, Clone:240230B6)(red) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), or 0.25 ug Isotype Control(blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 98082-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98082-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98082-1-RR against Mouse IFN-beta were performed. The affinity constant is 1.91 nM.

IFN-beta Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98082-1-PBS

Clone No.240230B6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

Ifnb1, 240230B6, Ifb, IFN beta, IFNB

---

Product Information

98082-1-PBS targets IFN-beta in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0660

  Product name: Recombinant Mouse IFN-beta protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 22-182 aa of NM_010510.1

  Sequence: INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN

• Full Name: interferon beta 1, fibroblast
• Calculated Molecular Weight: 22KD
• GenBank Accession Number: NM_010510.1
• Gene Symbol: Ifnb1
• Gene ID (NCBI): 15977
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01575
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interferon-beta (IFN-β) is a type I interferon, which is a group of signaling proteins made and released by host cells in response to the presence of several viruses, including double-stranded RNA produced by many viruses. IFN-β is a single protein species and is molecularly related to IFN-α subtypes, although it is antigenically distinct from them. It is mainly produced by fibroblasts and plays a crucial role in the innate immune response against viruses. IFN-β can inhibit viral replication by interfering with the virus's RNA or DNA, thus suppressing viral growth. It also enhances the cytotoxic activity of natural killer (NK) cells and promotes the expression of major histocompatibility complex (MHC) class I molecules.