Product Information
83068-2-PBS targets IFNAR2 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag0191 Product name: Recombinant human IFNAR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 230-331 aa of BC002793 Sequence: LPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD Predict reactive species |
Full Name | interferon (alpha, beta and omega) receptor 2 |
Calculated Molecular Weight | 331 aa, 37 kDa |
GenBank Accession Number | BC002793 |
Gene Symbol | IFNAR2 |
Gene ID (NCBI) | 3455 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P48551 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |