Tested Applications
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21825-1-AP targets IFRG15 in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag16156 Product name: Recombinant human IFRG15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC098348 Sequence: MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK Predict reactive species | 
                                    
| Full Name | interferon responsive gene 15 | 
| Calculated Molecular Weight | 470 aa, 51 kDa | 
| GenBank Accession Number | BC098348 | 
| Gene Symbol | IFRG15 | 
| Gene ID (NCBI) | 64163 | 
| RRID | AB_2878922 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q05BU2 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
IFRG15 is a 15 kDa interferon-responsive protein. It's different to the TOR1AIP2 isoform.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IFRG15 antibody 21825-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 







