IFRG15 Polyclonal antibody

• 

  IHC staining of human kidney using 21825-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21825-1-AP (IFRG15 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 21825-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21825-1-AP (IFRG15 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human kidney using 21825-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21825-1-AP (IFRG15 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 21825-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21825-1-AP (IFRG15 Antibody) at dilution of 1:50 (under 40x lens).

IFRG15 Polyclonal Antibody for IHC, ELISA

Cat No. 21825-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

IFRG15, interferon responsive gene 15

---

Tested Applications

• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21825-1-AP targets IFRG15 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16156

  Product name: Recombinant human IFRG15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC098348

  Sequence: MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK

• Full Name: interferon responsive gene 15
• Calculated Molecular Weight: 470 aa, 51 kDa
• GenBank Accession Number: BC098348
• Gene Symbol: IFRG15
• Gene ID (NCBI): 64163
• RRID: AB_2878922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05BU2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFRG15 is a 15 kDa interferon-responsive protein. It's different to the TOR1AIP2 isoform.