• Featured Product
  • KD/KO Validated

IGF2BP1 Polyclonal antibody

IGF2BP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 22803-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

IMP 1, IGF-II mRNA-binding protein 1, IGF2BP 1, IGF2 mRNA-binding protein 1, CRD-BP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, mouse kidney tissue, A375 cells, rat kidney tissue, HepG2 cells, HuH-7 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman lung cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22803-1-AP targets IGF2BP1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18859

Product name: Recombinant human IGF2BP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 126-198 aa of BC156957

Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL

Predict reactive species
Full Name insulin-like growth factor 2 mRNA binding protein 1
Calculated Molecular Weight 577 aa, 63 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC156957
Gene Symbol IGF2BP1
Gene ID (NCBI) 10642
RRIDAB_2879173
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NZI8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa.

Protocols

Product Specific Protocols
IF protocol for IGF2BP1 antibody 22803-1-APDownload protocol
IHC protocol for IGF2BP1 antibody 22803-1-APDownload protocol
IP protocol for IGF2BP1 antibody 22803-1-APDownload protocol
WB protocol for IGF2BP1 antibody 22803-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

An in vitro system to silence mitochondrial gene expression.

Authors - Luis Daniel Cruz-Zaragoza
  • KD Validated
humanWB

Cell

In vivo structural characterization of the SARS-CoV-2 RNA genome identifies host proteins vulnerable to repurposed drugs.

Authors - Lei Sun
  • KD Validated
humanWB

Cell Res

Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells.

Authors - Fei Peng
mouseIHC,IF,WB

ACS Cent Sci

Allosteric Regulation of IGF2BP1 as a Novel Strategy for the Activation of Tumor Immune Microenvironment

Authors - Yang Liu
humanWB

Mol Cell

m6A modification negatively regulates translation by switching mRNA from polysome to P-body via IGF2BP3

Authors - Ting Shan
  • KD Validated
human,mouseWB

Adv Sci (Weinh)

SREBP1c-Mediated Transcriptional Repression of YME1L1 Contributes to Acute Kidney Injury by Inducing Mitochondrial Dysfunction in Tubular Epithelial Cells

Authors - Wang Xin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Roy (Verified Customer) (06-13-2024)

Worked very well to detect IGF2BP1 at around 70 kDa by WB in HeLa cells (with an overnight incubation at 4°C, 1/1000 dilution)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa cells
FH

tao (Verified Customer) (12-14-2022)

Immunofluorescence seems to work, but signal can be detected in the nucleus

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
FH

Parisa (Verified Customer) (06-13-2022)

I used the antibody and it worked very well, It was sensitive and could detect the faint band that I expected in my IP.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hek293
Loading...
||
New chat Able
正在加载,请稍候...