Tested Applications
| Positive IF/ICC detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-22803 targets IGF2BP1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18859 Product name: Recombinant human IGF2BP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 126-198 aa of BC156957 Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL Predict reactive species |
| Full Name | insulin-like growth factor 2 mRNA binding protein 1 |
| Calculated Molecular Weight | 577 aa, 63 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC156957 |
| Gene Symbol | IGF2BP1 |
| Gene ID (NCBI) | 10642 |
| RRID | AB_3672751 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZI8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 IGF2BP1 antibody CL488-22803 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

