CoraLite® Plus 488-conjugated IGF2BP3 Monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-66526

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 IGF2BP3 antibody (CL488-66526, Clone: 2C10B11 ) at dilution of 1:200.

IGF2BP3 Monoclonal Antibody for IF/ICC

Cat No. CL488-66526

Clone No.2C10B11

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF/ICC

Synonyms

DKFZp686F1078, hKOC, IGF II mRNA binding protein 3, IGF2 mRNA binding protein 3, IGF2BP3, IMP 3, IMP3, KOC1, VICKZ family member 3, VICKZ3

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66526 targets IGF2BP3 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6349

  Product name: Recombinant human IGF2BP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 240-579 aa of BC065269

  Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

• Full Name: insulin-like growth factor 2 mRNA binding protein 3
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC065269
• Gene Symbol: IGF2BP3
• Gene ID (NCBI): 10643
• RRID: AB_2934475
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O00425
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

IGF2BP3, also named as IMP3, KOC1 and VICKZ3, belongs to the RRM IMP/VICKZ family. It is one of the RNA binding proteins involved in mRNA localization and translational control. IGF2BP3 is expressed during embryogenesis, as well as in some malignant tumors. It can be used as an independent prognostic factor for osteosarcoma.