CoraLite® Plus 488-conjugated IGFBP6 Monoclonal antibody

IGFBP6 Monoclonal Antibody for
Cat No. CL488-67567
Clone No.1D12B3

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IBP 6, IBP6, IGF binding protein 6, IGFBP 6, IGFBP6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-67567 targets IGFBP6 in applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30050

Product name: Recombinant human IGFBP6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 121-240 aa of BC011708

Sequence: KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Predict reactive species
Full Name insulin-like growth factor binding protein 6
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 30-33 kDa
GenBank Accession NumberBC011708
Gene Symbol IGFBP6
Gene ID (NCBI) 3489
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24592
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Insulin-like growth factor (IGF) binding protein (IGFBP6), a 240 amino acid protein, contains an IGFBP N-terminal domain and a thyroglobulin type-1 domain. It modulates the activity of IGF and shows independent effects of IGF, such as growth inhibition and apoptosis. It can decrease the proliferation and survival of cancer cells such as lung cancer cells and naso-pharyngeal cancer cells. IGFBP-6 is distinctive for its 50-fold higher binding affinity for IGF-II over IGF-I and this specificity makes it an attractive potential therapeutic candidate for IGF-II-dependent pediatric malignancies such as rhabdomyosarcoma (RMS). In addition, it was found that IGFBP6 can promote the migration of RMS cells in an IGF-independent manner, and MAPK pathways were involved in this process. Further study reported that IGFBP6 is one of most highly expressed proteins in varicose vein tissues and is involved in the proliferation of vascular smooth muscle cells (VSMCs), which may provide insights into the underlying pathogenesis of varicose vein.

Loading...
||
New chat Able
正在加载,请稍候...