IGFBP6 Monoclonal antibody

IGFBP6 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67567-1-Ig
Clone No.1D12B3

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

IGFBP 6, IGF-binding protein 6, IGF binding protein 6, IBP-6, IBP6

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-87 MG cells, human testis tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHaCaT cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 2 publications below

Product Information

67567-1-Ig targets IGFBP6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, monkey
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30050

Product name: Recombinant human IGFBP6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 121-240 aa of BC011708

Sequence: KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Predict reactive species
Full Name insulin-like growth factor binding protein 6
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 30-33 kDa
GenBank Accession NumberBC011708
Gene Symbol IGFBP6
Gene ID (NCBI) 3489
RRIDAB_2882781
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24592
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Insulin-like growth factor (IGF) binding protein (IGFBP6), a 240 amino acid protein, contains an IGFBP N-terminal domain and a thyroglobulin type-1 domain. It modulates the activity of IGF and shows independent effects of IGF, such as growth inhibition and apoptosis. It can decrease the proliferation and survival of cancer cells such as lung cancer cells and naso-pharyngeal cancer cells. IGFBP-6 is distinctive for its 50-fold higher binding affinity for IGF-II over IGF-I and this specificity makes it an attractive potential therapeutic candidate for IGF-II-dependent pediatric malignancies such as rhabdomyosarcoma (RMS). In addition, it was found that IGFBP6 can promote the migration of RMS cells in an IGF-independent manner, and MAPK pathways were involved in this process. Further study reported that IGFBP6 is one of most highly expressed proteins in varicose vein tissues and is involved in the proliferation of vascular smooth muscle cells (VSMCs), which may provide insights into the underlying pathogenesis of varicose vein.

Protocols

Product Specific Protocols
WB protocol for IGFBP6 antibody 67567-1-IgDownload protocol
IHC protocol for IGFBP6 antibody 67567-1-IgDownload protocol
IF protocol for IGFBP6 antibody 67567-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Neurol Res

The clinical characteristics and prognostic value of IGFBP6 in glioma.

Authors - Zhitao Zong
monkeyIHC

Front Cell Dev Biol

Chondrocyte-like cells in nucleus pulposus and articular chondrocytes have similar transcriptomic profiles and are paracrine-regulated by hedgehog from notochordal cells and subchondral bone

Authors - Hiroki Hagizawa
Loading...
||
New chat Able
正在加载,请稍候...