Tested Applications
| Positive WB detected in | Jurkat cells, mouse brain tissue, rat brain tissue, rat lung tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human liver cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 107 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
15649-1-AP targets IKKB in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8191 Product name: Recombinant human IKBKB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC006231 Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS Predict reactive species |
| Full Name | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
| Calculated Molecular Weight | 756aa,81 kDa; 256aa,29 kDa |
| Observed Molecular Weight | 80 kDa, 86 kDa, 87 and 29 kDa |
| GenBank Accession Number | BC006231 |
| Gene Symbol | IKBKB |
| Gene ID (NCBI) | 3551 |
| RRID | AB_2122307 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14920 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IKBKB, also named as IKKB, IKK2, NFKBIKB and IKK-B, belongs to the protein kinase superfamily, Ser/Thr protein kinase family and I-kappa-B kinase subfamily. IKBKB is a Serine kinase that plays an essential role in the NF-kappa-B signaling pathway. It acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. In addition to the NF-kappa-B inhibitors, IKBKB phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. It also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, IKBKB acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. This antibody can identify 4 isoform of IKBKB with the molecular weight of 80, 86, 87 and 29 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IKKB antibody 15649-1-AP | Download protocol |
| IP protocol for IKKB antibody 15649-1-AP | Download protocol |
| WB protocol for IKKB antibody 15649-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice | ||
Adv Sci (Weinh) Sirtuin 5-Mediated Desuccinylation of ALDH2 Alleviates Mitochondrial Oxidative Stress Following Acetaminophen-Induced Acute Liver Injury | ||
Drug Des Devel Ther Sichen Formula Ameliorates Lipopolysaccharide-Induced Acute Lung Injury via Blocking the TLR4 Signaling Pathways | ||
Cell Death Discov tRNA-derived fragment TRF365 regulates the metabolism of anterior cruciate ligament cells by targeting IKBKB. | ||
Redox Biol Cardioprotection of CAPE-oNO2 against myocardial ischemia/reperfusion induced ROS generation via regulating the SIRT1/eNOS/NF-κB pathway in vivo and in vitro. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Eugenia (Verified Customer) (03-16-2022) | Antibody worked well with specific band although a couple of non-specific bands also appeared.
|













