Anti-Mouse IL-20RB Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using 98569-3-RR

  1x10^6 HEK-293T cells (left) or IL-20RB-transfected HEK-293T cells (right) were surface stained with 0.25 ug Anti-Mouse IL-20RB Rabbit RecAb (98569-3-RR, Clone:250596B5), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  FC experiment of Transfected HEK-293T using 98569-3-RR

  1x10^6 HEK-293T cells (left) or IL-20RB-transfected HEK-293T cells (right) were surface stained with 0.25 ug Anti-Mouse IL-20RB Rabbit RecAb (98569-3-RR, Clone: 250596B5)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9)(blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  Affinity of 98569-3-RR

  Biolayer interferometry (BLl) kinetic assays of 98569-3-RR against Mouse IL-20RB were performed. The affinity constant is below 1 pM.

IL-20RB Uni-rAb^® Recombinant Antibody for FC

Cat No. 98569-3-RR

Clone No.250596B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC

Synonyms

DIRS1, FNDC6, IL-20R2, Il20rb , IL-20R-Beta

---

Tested Applications

• Positive FC detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98569-3-RR targets IL-20RB in FC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3168

  Product name: Recombinant Mouse IL-20RB protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-225 aa of NM_001033543.3

  Sequence: VSVLPAPQNLSVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES

• Full Name: interleukin 20 receptor beta
• Calculated Molecular Weight: 34 kDa
• GenBank Accession Number: NM_001033543.3
• Gene Symbol: Il20rb
• Gene ID (NCBI): 213208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: E9Q9A6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Interleukin-20 receptor subunit beta (IL20RB) is a single-pass type I membrane protein of the type II cytokine receptor family. The interleukin-20-receptor I complex (IL-20-RI) is composed of two chains, IL20RA and IL20RB. IL-20-RI is a receptor for IL-19, IL-20 and IL-24. IL20RB can also form a heterodimer with IL22RA1. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24.