IL-27A p28 Polyclonal antibody

• 

  WB analysis using 32596-1-AP

  Human IL-27 Recombinant protein (Cat No.Eg0897) and IL-27A Recombinant protein(Cat No. Eg5066) were subjected to SDS PAGE followed by western blot with 32596-1-AP(IL-27 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

IL-27A p28 Polyclonal Antibody for WB, ELISA

Cat No. 32596-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

IL-27 p28/IL-30, Il27, IL-27 p28, IL-27 subunit alpha, Il27a

---

Tested Applications

• Positive WB detected in: IL-27A Recombinant protein Eg5066, IL-27 Recombinant protein (Cat No.Eg0897)

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32596-1-AP targets IL-27A p28 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0897

  Product name: Recombinant Mouse IL-27A protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 29-234 aa of

  Sequence: FPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

• Full Name: interleukin 27
• Gene Symbol: Il27
• Gene ID (NCBI): 50498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O35228(IL27B)+Q8K3I6(IL27A)
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IL-27, as a member of the IL-6/IL-12 family, is a heterodimeric cytokine composed of two subunits: p28 (IL-27a) and EBI3 (IL-27b). IL-27 acts on various cell types, including T cells, B cells, macrophages, dendritic cells, natural killer (NK) cells and non-hematopoietic cells. IL-27 plays a critical role in the early regulation of T helper type 1 initiation, and enhances proliferation of naive CD4+T cells and naive B cells. It, however, also exerts anti-inflammatory functions by inhibiting the development of Th17 cells and inducing IL-10 producing type 1 regulatory T cells. IL-27 is a potentially promising cytokine for therapeutic approaches on various human diseases.