Mouse IL-4 Recombinant monoclonal antibody, PBS Only

• 

IL-4 antibodies are versatile tools for investigating IL-4’s roles in immunity, allergy, autoimmunity, and cancer, supporting a wide range of molecular, cellular, and functional assays. Proteintech has an extensive range of validated IL-4 antibodies antibodies for WB, IHC, IF-P, ELISA and more.

Cat No. 85179-3-PBS

Clone No.242736E4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Indirect ELISA

Synonyms

Il 4, Il4, interleukin 4

---

Product Information

85179-3-PBS targets IL-4 in Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3750

  Product name: Recombinant Mouse IL-4 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-140 aa of BC027514

  Sequence: HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

• Full Name: interleukin 4
• GenBank Accession Number: BC027514
• Gene Symbol: IL-4
• Gene ID (NCBI): 16189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07750
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.