IL9R Recombinant monoclonal antibody

• 

  WB analysis using 87379-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87379-1-RR (IL9R antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87379-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87379-1-RR against Human IL9R were performed. The affinity constant is 4.84 nM.

IL9R Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87379-1-RR

Clone No.252405E6

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

CD129, IL 9 receptor, IL 9R, IL-9 receptor, IL-9R

---

Tested Applications

• Positive WB detected in: MJ cells, PC-3 cells, HEK-293T cells, A549 cells, C6 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87379-1-RR targets IL9R in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2902

  Product name: recombinant human IL9R protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 40-270 aa of NM_002186.2

  Sequence: VSVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

• Full Name: interleukin 9 receptor
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: NM_002186.2
• Gene Symbol: IL9R
• Gene ID (NCBI): 3581
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01113-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-9 (IL-9) is a cytokine produced by various cell types including TH2, TH9, TH17, regulatory T (Treg) cells, mast cells, type 2 innate lymphoid cells (ILC2), and CD8+ T cells. IL-9 activates the phosphorylation of Janus kinase 1 (JAK1) and JAK3 by binding to its receptor, IL-9R, thus initiating downstream transcriptional signaling and exerting its biological functions.