ILK Polyclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 24926-1-AP (same clone as 24926-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 24926-1-AP (ILK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24926-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 24926-1-AP (same clone as 24926-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 24926-1-AP (ILK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24926-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 24926-1-AP (same clone as 24926-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24926-1-AP (ILK Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24926-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 24926-1-AP (same clone as 24926-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 24926-1-AP (ILK Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24926-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 24926-1-AP (same clone as 24926-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 24926-1-AP (ILK antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24926-1-PBS in a different storage buffer formulation.

ILK Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 24926-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24926-1-PBS targets ILK in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21494

  Product name: Recombinant human ILK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-452 aa of BC001554

  Sequence: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

• Full Name: integrin-linked kinase
• Calculated Molecular Weight: 451 aa, 59 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC001554
• Gene Symbol: ILK
• Gene ID (NCBI): 3611
• RRID: AB_2879800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13418
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ILK(Integrin-linked protein kinase) is also named as p59, PAT-4, DKFZp686F1765, ILK-1, ILK-2, ILK1, ILK2, p59ILK and belongs to the TKL Ser/Thr protein kinase family. This protein localizes to multiple sites, including the cytoplasm, and imports into the nucleus through sequences in its N-terminus, via active transport mechanisms that involve nuclear pore complexes(PMID: 18635968). ILK performs crucial roles in the control of intestinal cell and crypt-villus axis homeostasis-especially with regard to basement membrane fibronectin deposition-as well as cell proliferation, spreading, and migration(PMID:19885839).