Product Information
60023-1-Ig targets IMMT in ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0102 Product name: Recombinant human IMMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-297 aa of BC002412 Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK Predict reactive species |
| Full Name | inner membrane protein, mitochondrial (mitofilin) |
| Calculated Molecular Weight | 90 kDa |
| GenBank Accession Number | BC002412 |
| Gene Symbol | IMMT |
| Gene ID (NCBI) | 10989 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16891 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function. Three isoforms of mitofilin exist due to the alternative splicing. All three proteins of 87kD, 89kD and 80kD can be detected in immunoblot analysis with this antibody.
