ING3 Polyclonal antibody

• 

  WB analysis of mouse uterus using 10905-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 10905-1-AP (ING3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10905-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10905-1-AP (ING3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 10905-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10905-1-AP (ING3 antibody) at dilution of 1:100 (under 10x lens).

• Featured Product
• KD/KO Validated

ING3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10905-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, IHC, ELISA

Synonyms

Eaf4, ING2, ING3, Inhibitor of growth protein 3, p47ING3

---

Tested Applications

• Positive WB detected in: mouse uterus tissue, HepG2 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 3 publications below
• IP: See 1 publications below

Product Information

10905-1-AP targets ING3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1357

  Product name: Recombinant human ING3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC009777

  Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF

• Full Name: inhibitor of growth family, member 3
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC009777
• Gene Symbol: ING3
• Gene ID (NCBI): 54556
• RRID: AB_2127780
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXR8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Members of inhibitor of growth (ING) family function in inhibiting cell growth and inducing apoptosis. They are sequence homologous proteins. ING3 can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. This antibody is specifically against p47ING3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Clin Cancer Res; Prognostic significance of nuclear ING3 expression in human cutaneous melanoma.; Authors - Wang Yemin Y
human	WB	Oncogene; The tumor suppressor ING3 is degraded by SCF(Skp2)-mediated ubiquitin-proteasome system.; Authors - Chen G G ; KD Validated
human	WB	Mol Cell Biol; p90 RSK2 mediates antianoikis signals by both transcription-dependent and -independent mechanisms.; Authors - Jin Lingtao L
human	IHC	Front Oncol; Nuclear ING3 Expression Is Correlated With a Good Prognosis of Breast Cancer.; Authors - Xiaoyan Wu
human	WB	Mol Cancer Res; RSK Promotes Prostate Cancer Progression in Bone through ING3, CKAP2 and PTK6-mediated Cell Survival.; Authors - Guoyu Yu
human	WB,IHC	Indian J Med Res; Downregulated inhibitor of growth 3 (ING3) expression during colorectal carcinogenesis.; Authors - Wen-Feng Gou