Tested Applications
Positive WB detected in | mouse uterus tissue, HepG2 cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 5 publications below |
IHC | See 3 publications below |
IP | See 1 publications below |
Product Information
10905-1-AP targets ING3 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1357 Product name: Recombinant human ING3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC009777 Sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF Predict reactive species |
Full Name | inhibitor of growth family, member 3 |
Calculated Molecular Weight | 46 kDa |
Observed Molecular Weight | 47 kDa |
GenBank Accession Number | BC009777 |
Gene Symbol | ING3 |
Gene ID (NCBI) | 54556 |
RRID | AB_2127780 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NXR8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Members of inhibitor of growth (ING) family function in inhibiting cell growth and inducing apoptosis. They are sequence homologous proteins. ING3 can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. This antibody is specifically against p47ING3.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ING3 antibody 10905-1-AP | Download protocol |
IHC protocol for ING3 antibody 10905-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Clin Cancer Res Prognostic significance of nuclear ING3 expression in human cutaneous melanoma. | ||
Oncogene The tumor suppressor ING3 is degraded by SCF(Skp2)-mediated ubiquitin-proteasome system.
| ||
Mol Cell Biol p90 RSK2 mediates antianoikis signals by both transcription-dependent and -independent mechanisms. | ||
Front Oncol Nuclear ING3 Expression Is Correlated With a Good Prognosis of Breast Cancer. | ||
Mol Cancer Res RSK Promotes Prostate Cancer Progression in Bone through ING3, CKAP2 and PTK6-mediated Cell Survival. | ||
Indian J Med Res Downregulated inhibitor of growth 3 (ING3) expression during colorectal carcinogenesis. |