INO80C Polyclonal antibody, PBS Only

• 

  IHC staining of human breast cancer using 24793-1-AP (same clone as 24793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24793-1-AP (INO80C Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24793-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24793-1-AP (same clone as 24793-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24793-1-AP (INO80C Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24793-1-PBS in a different storage buffer formulation.

INO80C Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24793-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24793-1-PBS targets INO80C in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20468

  Product name: Recombinant human INO80C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-96 aa of BC048989

  Sequence: MEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLAN

• Full Name: INO80 complex subunit C
• Calculated Molecular Weight: 192 aa, 21 kDa
• GenBank Accession Number: BC048989
• Gene Symbol: INO80C
• Gene ID (NCBI): 125476
• RRID: AB_2879729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PI98
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.