INPP5B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• INPP5B Polyclonal antibody (15141-1-AP)

INPP5B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15141-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

5PTase, 75 kDa inositol polyphosphate-5-phosphatase, EC:3.1.3.36, INPP5, OCRL2

• 

  WB analysis of mouse spleen using 15141-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15141-1-AP

  Mouse spleen tissue was subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15141-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 15141-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 15141-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 15141-1-AP (INPP5B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 15141-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 15141-1-AP (INPP5B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for INPP5B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, HeLa cells, human placenta tissue
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15141-1-AP targets INPP5B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7315

  Product name: Recombinant human INPP5B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-309 aa of BC058932

  Sequence: MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKE

• Full Name: inositol polyphosphate-5-phosphatase, 75kDa
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC058932
• Gene Symbol: INPP5B
• Gene ID (NCBI): 3633
• RRID: AB_2126133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32019
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INPP5B(Type II inositol 1,4,5-trisphosphate 5-phosphatase) is also named as OCRL2,5PTase, 75 kDa inositol polyphosphate-5-phosphatase and belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family. This protein, originally described in platelets, is one of at least three known enzymes capable of dephosphorylating inositol-1,4,5-trisphosphate (IP3) to inositol-1,4-bisphosphate (IP2)(PMID:8125013). It has 4 isoforms produced by alternative splicing.

Publications

What published studies show

The INPP5B Polyclonal antibody (catalog #15141-1-AP) has 7 citations. Journals include Cell Metabolism, Journal of the American Society of Nephrology, Cancer Cell International, Life Sciences, Biochimica et Biophysica Acta – Molecular Basis of Disease, Journal of Biological Chemistry, and PLoS ONE. Research fields span metabolic adaptation, renal disease (Lowe syndrome), lung adenocarcinoma prognosis, hepatic lipogenesis, atherosclerotic macrophage polarization, sterol biosynthesis, and primary cilia formation. Applications include WB, IP, IF, and IHC in human and mouse studies.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Metab; Isoform usage as a distinct regulatory layer driving nutrient-responsive metabolic adaptation; Authors - Jia Li
human	WB	J Am Soc Nephrol; Effects of Proximal Tubule Shortening on Protein Excretion in a Lowe Syndrome Model.; Authors - Megan L Gliozzi
human	WB	Cancer Cell Int; Decreased INPP5B expression predicts poor prognosis in lung adenocarcinoma.; Authors - Jun Deng
mouse	WB,IP	Life Sci; NIK suppresses AKT/ACLY pathway-mediated lipogenesis in liver by stabilizing INPP5B during chronic ethanol exposure.; Authors - Wen Zhang ; KD Validated
mouse	WB	Biochim Biophys Acta Mol Basis Dis; Integrated application of transcriptome and metabolomics reveals potential therapeutic targets for the polarization of atherosclerotic macrophages; Authors - Lin Shen
human	IF	J Biol Chem; Comparative proximity biotinylation implicates the small GTPase RAB18 in sterol mobilization and biosynthesis; Authors - Robert S Kiss