INPP5B Polyclonal antibody

• 

  WB analysis of mouse spleen using 15141-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15141-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 15141-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15141-1-AP (INPP5B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse pancreas using 15141-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 15141-1-AP (INPP5B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 15141-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 15141-1-AP (INPP5B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

INPP5B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15141-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

5PTase, INPP5B, Phosphoinositide 5 phosphatase

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, HeLa cells, human placenta tissue
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

15141-1-AP targets INPP5B in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7315

  Product name: Recombinant human INPP5B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-309 aa of BC058932

  Sequence: MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQELDLSKE

• Full Name: inositol polyphosphate-5-phosphatase, 75kDa
• Calculated Molecular Weight: 113 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC058932
• Gene Symbol: INPP5B
• Gene ID (NCBI): 3633
• RRID: AB_2126133
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32019
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

INPP5B(Type II inositol 1,4,5-trisphosphate 5-phosphatase) is also named as OCRL2,5PTase, 75 kDa inositol polyphosphate-5-phosphatase and belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family. This protein, originally described in platelets, is one of at least three known enzymes capable of dephosphorylating inositol-1,4,5-trisphosphate (IP3) to inositol-1,4-bisphosphate (IP2)(PMID:8125013). It has 4 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Am Soc Nephrol; Effects of Proximal Tubule Shortening on Protein Excretion in a Lowe Syndrome Model.; Authors - Megan L Gliozzi
human	WB	Cancer Cell Int; Decreased INPP5B expression predicts poor prognosis in lung adenocarcinoma.; Authors - Jun Deng
human, mouse	WB,IHC	PLoS One; Compensatory Role of Inositol 5-Phosphatase INPP5B to OCRL in Primary Cilia Formation in Oculocerebrorenal Syndrome of Lowe.; Authors - Luo Na N
mouse	WB	Biochim Biophys Acta Mol Basis Dis; Integrated application of transcriptome and metabolomics reveals potential therapeutic targets for the polarization of atherosclerotic macrophages; Authors - Lin Shen
human	IF	J Biol Chem; Comparative proximity biotinylation implicates the small GTPase RAB18 in sterol mobilization and biosynthesis; Authors - Robert S Kiss