Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, Jurkat cells, NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31428-1-AP targets INTS1 in WB, ELISA applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35428 Product name: Recombinant human INTS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 280-400 aa of BC069262 Sequence: GAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGS Predict reactive species |
| Full Name | integrator complex subunit 1 |
| Observed Molecular Weight | 250 kDa |
| GenBank Accession Number | BC069262 |
| Gene Symbol | INTS1 |
| Gene ID (NCBI) | 26173 |
| RRID | AB_3669979 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N201 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
INTS1 is a component of the Integrator (INT) complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for INTS1 antibody 31428-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

