Product Information
84339-1-PBS targets INTS1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag35428 Product name: Recombinant human INTS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 280-400 aa of BC069262 Sequence: GAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGS Predict reactive species |
| Full Name | integrator complex subunit 1 |
| GenBank Accession Number | BC069262 |
| Gene Symbol | INTS1 |
| Gene ID (NCBI) | 26173 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8N201 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
