IPMK Polyclonal antibody, PBS Only

• 

  WB analysis using 30161-1-AP (same clone as 30161-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30161-1-AP (IPMK antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30161-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30161-1-AP (same clone as 30161-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using IPMK antibody (30161-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30161-1-PBS in a different storage buffer formulation.

IPMK Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30161-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30161-1-PBS targets IPMK in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32377

  Product name: Recombinant human IPMK protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-295 aa of BC065709

  Sequence: ESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKILQWFENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNF

• Full Name: inositol polyphosphate multikinase
• Observed Molecular Weight: 42-47 kDa
• GenBank Accession Number: BC065709
• Gene Symbol: IPMK
• Gene ID (NCBI): 253430
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IPMK plays an important role in MLKL-mediated necroptosis via its role in the biosynthesis of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). It is required for normal embryonic development, probably via its role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate (Ins(1,3,4,5,6)P5) and inositol hexakisphosphate (InsP6).