IPO5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67962-1-Ig (same clone as 67962-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67962-1-Ig (IPO5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Lamin B1 Monoclonal antibody (66095-1-Ig) as loading control. This data was developed using the same antibody clone with 67962-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67962-1-Ig (same clone as 67962-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67962-1-Ig (IPO5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67962-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67962-1-Ig (same clone as 67962-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using IPO5 antibody (67962-1-Ig, Clone: 1E2B9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67962-1-PBS in a different storage buffer formulation.

IPO5 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67962-1-PBS

Clone No.1E2B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1E2B9, IMB3, Imp5, importin 5, Importin subunit beta 3

---

Product Information

67962-1-PBS targets IPO5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30955

  Product name: Recombinant human IPO5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-150 aa of BC001497

  Sequence: DNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA

• Full Name: importin 5
• Observed Molecular Weight: 124 kDa
• GenBank Accession Number: BC001497
• Gene Symbol: IPO5
• Gene ID (NCBI): 3843
• RRID: AB_2918713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00410
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IPO5 is a member of the importin beta family. Structurally, the protein adopts the shape of a right-hand solenoid and is composed of 24 HEAT repeats. IPO5 facilitates cytoplasmic polyadenylation element-binding protein CPEB3 translocation by binding to the RRM1 motif of CPEB3 in neurons. NMDAR signaling increases RanBP1 expression and reduces the level of cytoplasmic GTP-bound Ran. These changes enhance CPEB3-IPO5 interaction, which consequently accelerates the nuclear import of CPEB3 and promotes its nuclear function.